Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHLH2 Rabbit Polyclonal Antibody (HRP)

NHLH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEN2, NSCL2, bHLHa34

UniProt

Q02577

Immunogen

The immunogen for Anti-NHLH2 antibody is: synthetic peptide directed towards the N-terminal of Human HEN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_006710729.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KAT2A/GCN5 Antibody Picoband®
PB9713 100 µg/Vial

Anti-KAT2A/GCN5 Antibody Picoband®

Sign In for Pricing
View Details
Ag Nanoparticles
NM000629 10 mL

Ag Nanoparticles

Sign In for Pricing
View Details
Rat Bsg ELISA Kit
orb567085-01 48 Tests

Rat Bsg ELISA Kit

Sign In for Pricing
View Details
Rat Bsg ELISA Kit
orb567085-02 96 Tests

Rat Bsg ELISA Kit

Sign In for Pricing
View Details
HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I)
MBS647556-01 0.2 mL

HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I)

Sign In for Pricing
View Details
HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I)
MBS647556-02 5x 0.2 mL

HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I)

Sign In for Pricing
View Details