Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5a Anaphylatoxin (human)

C5a Anaphylatoxin (human)

Product Specifications

Purity

≥95%

Notes

For research use only.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO31 Rabbit pAb (APR19502N)
APR19502N-01 50 µL

FBXO31 Rabbit pAb (APR19502N)

Sign In for Pricing
View Details
FBXO31 Rabbit pAb (APR19502N)
APR19502N-02 100 µL

FBXO31 Rabbit pAb (APR19502N)

Sign In for Pricing
View Details
FBXO31 Rabbit pAb (APR19502N)
APR19502N-03 200 µL

FBXO31 Rabbit pAb (APR19502N)

Sign In for Pricing
View Details
Mouse GR-β ELISA Kit
EMG0368 96 Tests

Mouse GR-β ELISA Kit

Sign In for Pricing
View Details
4-Tolyl Ether
OR1030273-01 5 g

4-Tolyl Ether

Sign In for Pricing
View Details
4-Tolyl Ether
OR1030273-02 25 g

4-Tolyl Ether

Sign In for Pricing
View Details