Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO31 Rabbit pAb (APR19502N)

Product Specifications

Background

This gene is a member of the F-box family. Members are classified into three classes according to the substrate interaction domain, FBW for WD40 repeats, FBL for leucing-rich repeats, and FBXO for other domains. This protein, classified into the last category because of the lack of a recognizable substrate binding domain, has been proposed to be a component of the SCF ubiquitination complex. It is thought to bind and recruit substrate for ubiquitination and degradation. This protein may have a role in regulating the cell cycle as well as dendrite growth and neuronal migration. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FBXO31 Rabbit pAb (APR19502N) .

Synonyms

FBXO31; FBX14; FBXO14; Fbx31; MRT45; pp2386

Gene ID

79791

UniProt

Q5XUX0

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79791

Uniprot URL

https://www.uniprot.org/uniprot/Q5XUX0

AA Sequence

GGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXD3 ORF Vector (Human) (pORF)
ORF003677 1.0 µg DNA

EXD3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Slmo2 3'UTR GFP Stable Cell Line
TU169276 1.0 mL

Slmo2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Zinc finger protein 654, ZNF654 ELISA Kit
MBS9326921-01 48 Well

Mouse Zinc finger protein 654, ZNF654 ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger protein 654, ZNF654 ELISA Kit
MBS9326921-02 96 Well

Mouse Zinc finger protein 654, ZNF654 ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger protein 654, ZNF654 ELISA Kit
MBS9326921-03 5x 96 Well

Mouse Zinc finger protein 654, ZNF654 ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger protein 654, ZNF654 ELISA Kit
MBS9326921-04 10x 96 Well

Mouse Zinc finger protein 654, ZNF654 ELISA Kit

Sign In for Pricing
View Details