Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCRAMP, mouse

MCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.

Product Specifications

Purity

≥95%

Molecular Weight

3878.7

Notes

For research use only.

AA Sequence

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HARS CRISPRa sgRNA lentivector (set of three targets)(Human)
23010121 3x 1.0µg DNA

HARS CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit Polyclonal UAP1L1 Antibody [DyLight 755]
NBP2-98049IR 0.1 mL

Rabbit Polyclonal UAP1L1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human ANKRD50 Protein - (Dry Ice)
H00057182-P01-25ug 25 µg

Recombinant Human ANKRD50 Protein - (Dry Ice)

Sign In for Pricing
View Details
Opn3 AAV siRNA Pooled Vector
34849166 1.0 µg

Opn3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human TPP1/CLN2 Protein (His Tag)
PKSH033493-01 10 µg

Recombinant Human TPP1/CLN2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TPP1/CLN2 Protein (His Tag)
PKSH033493-02 50 µg

Recombinant Human TPP1/CLN2 Protein (His Tag)

Sign In for Pricing
View Details