Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Profilin-1 (PRO1)

This Recombinant Phleum pratense Profilin-1 (PRO1) spans the amino acid sequence from region 2-131aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p 11; Pollen allergen Phl p 12; allergen Phl p 12

UniProt

P35079

Expression Region

2-131aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Phleum pratense (Common timothy)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axitinib N-Oxide
TRC-A254850-10MG 10 mg

Axitinib N-Oxide

Sign In for Pricing
View Details
2-Thiophenecarboxaldehyde
TRC-T368100-50G 50 g

2-Thiophenecarboxaldehyde

Sign In for Pricing
View Details
HID1 (NM_030630) Human Over-expression Lysate
LY403066 100 µg

HID1 (NM_030630) Human Over-expression Lysate

Sign In for Pricing
View Details
20(S)-Ginsenoside Rh1
TRC-G410175-5MG 5 mg

20(S)-Ginsenoside Rh1

Sign In for Pricing
View Details
IL17A Receptor Recombinant Rabbit Monoclonal Antibody [JE35-89]
HA721738 100 µL

IL17A Receptor Recombinant Rabbit Monoclonal Antibody [JE35-89]

Sign In for Pricing
View Details
DCBLD2 Antibody
KC-2480-01 50 μL

DCBLD2 Antibody

Sign In for Pricing
View Details