Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Myoglobin (MB)

This Recombinant Pig Myoglobin (MB) spans the amino acid sequence from region 2-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P02189

Expression Region

2-154aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1B15 Human Gene Knockout Kit (CRISPR)
KN419738 1 Kit

AKR1B15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (BA.1.1/Omicron) (MALS verified)
SPD-C522j-1mg 1 mg

SARS-CoV-2 Spike RBD Protein, His Tag (BA.1.1/Omicron) (MALS verified)

Sign In for Pricing
View Details
NAlpha-Benzoyl-DL-arginine Beta-Naphthylamide Hydrochloride
TRC-B207908-500MG 500 mg

NAlpha-Benzoyl-DL-arginine Beta-Naphthylamide Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS801575 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)
PDMH100111-01 20 µg

Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)
PDMH100111-02 100 µg

Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)

Sign In for Pricing
View Details