Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 (NDUFA4), partial

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 (NDUFA4), partial spans the amino acid sequence from region 38-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-MLRQ; CI-MLRQ; NADH-ubiquinone oxidoreductase MLRQ subunit

UniProt

O00483

Expression Region

38-81aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRE11 (phospho Ser264) rabbit pAb
ES6268-01 50 µL

MRE11 (phospho Ser264) rabbit pAb

Sign In for Pricing
View Details
MRE11 (phospho Ser264) rabbit pAb
ES6268-02 100 µL

MRE11 (phospho Ser264) rabbit pAb

Sign In for Pricing
View Details
ZDHHC17 Antibody (N-Term) [APR33401G]
APR33401G-01 50 µL

ZDHHC17 Antibody (N-Term) [APR33401G]

Sign In for Pricing
View Details
ZDHHC17 Antibody (N-Term) [APR33401G]
APR33401G-02 100 µL

ZDHHC17 Antibody (N-Term) [APR33401G]

Sign In for Pricing
View Details
ZDHHC17 Antibody (N-Term) [APR33401G]
APR33401G-03 200 µL

ZDHHC17 Antibody (N-Term) [APR33401G]

Sign In for Pricing
View Details
ZDHHC17 Antibody (N-Term) [APR33401G]
APR33401G-04 400 µL

ZDHHC17 Antibody (N-Term) [APR33401G]

Sign In for Pricing
View Details