Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4)

This Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4) spans the amino acid sequence from region 27-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MPGC60 protein; Peptide PEC-60 homolog

UniProt

O35679

Expression Region

27-86aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH1 Human shRNA Plasmid Kit (Locus ID 25981)
TL304966 1 Kit

DNAH1 Human shRNA Plasmid Kit (Locus ID 25981)

Sign In for Pricing
View Details
ERCC1 Rabbit Polyclonal Antibody (FITC)
orb2598515 100 µg

ERCC1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
GENLISA™ Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA
KBH1218 1x 96 Well

GENLISA™ Human Tissue Inhibitors Of Metalloproteinase 2 (TIMP2) ELISA

Sign In for Pricing
View Details
Keratin K71, IRS1 (Inner Root Sheath 1)
MBS616368-01 0.1 mL

Keratin K71, IRS1 (Inner Root Sheath 1)

Sign In for Pricing
View Details
Keratin K71, IRS1 (Inner Root Sheath 1)
MBS616368-02 5x 0.1 mL

Keratin K71, IRS1 (Inner Root Sheath 1)

Sign In for Pricing
View Details
CCDC153 discontinued
507736 100 µg

CCDC153 discontinued

Sign In for Pricing
View Details