Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Liver-expressed antimicrobial peptide 2 (LEAP2)

This Recombinant Human Liver-expressed antimicrobial peptide 2 (LEAP2) spans the amino acid sequence from region 38-77aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LEAP-2

UniProt

Q969E1

Expression Region

38-77aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Gastroenterology & Hepatology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-ATA
HY-133956 1 Each

3-ATA

Sign In for Pricing
View Details
CACNB2 Immunizing Peptide
MBS427647-01 0.1 mg

CACNB2 Immunizing Peptide

Sign In for Pricing
View Details
CACNB2 Immunizing Peptide
MBS427647-02 5x 0.1 mg

CACNB2 Immunizing Peptide

Sign In for Pricing
View Details
Tedizolid TZD 0.002-32
921361 10/Pack

Tedizolid TZD 0.002-32

Sign In for Pricing
View Details
WNT9B Protein Vector (Mouse) (pPM-C-HA)
50462024 500 ng

WNT9B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Carboxylesterase 1 ELISA Kit
MBS055531-01 48 Well

Mouse Carboxylesterase 1 ELISA Kit

Sign In for Pricing
View Details