Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cell surface glycoprotein CD200 receptor 1 (Cd200r1), partial, Biotinylated

This Recombinant Mouse Cell surface glycoprotein CD200 receptor 1 (Cd200r1), partial, Biotinylated spans the amino acid sequence from region 26-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD200 cell surface glycoprotein receptor; Cell surface glycoprotein OX2 receptor 1

UniProt

Q9ES57

Expression Region

26-238aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (NM_001131019) Human Over-expression Lysate
LC427360 20 µg

GFAP (NM_001131019) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP5PD Antibody
KC-42877-01 50 μL

ATP5PD Antibody

Sign In for Pricing
View Details
ATP5PD Antibody
KC-42877-02 100 µL

ATP5PD Antibody

Sign In for Pricing
View Details
ATP5PD Antibody
KC-42877-03 1 mL

ATP5PD Antibody

Sign In for Pricing
View Details
NpFR1
SIH-181-1MG 1 mg

NpFR1

Sign In for Pricing
View Details
CD79A Mouse Monoclonal Antibody [Clone ID: JCB117 + HM47/A9]
AM50250PU-S 100 µg

CD79A Mouse Monoclonal Antibody [Clone ID: JCB117 + HM47/A9]

Sign In for Pricing
View Details