Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Uncharacterized protein

This Recombinant Cricetulus griseus Uncharacterized protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G3HIE8

Expression Region

1-64aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGAGGRRAQGRFLRDGGFVMNQLSLKLTLCPTPDLGNKAHHDFSSYRNRKTNELQDQGLPNLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Leucine Rich Repeat Kinase 2 (LRRK2) ELISA Kit
YP-W35986-01 48 Tests

Rat Leucine Rich Repeat Kinase 2 (LRRK2) ELISA Kit

Sign In for Pricing
View Details
Rat Leucine Rich Repeat Kinase 2 (LRRK2) ELISA Kit
YP-W35986-02 96 Tests

Rat Leucine Rich Repeat Kinase 2 (LRRK2) ELISA Kit

Sign In for Pricing
View Details
Apaf-1 Antibody [13F11]
36-176 100 µg

Apaf-1 Antibody [13F11]

Sign In for Pricing
View Details
Rat Aldh1a1 ELISA Kit
ELI-02366r 96 Tests

Rat Aldh1a1 ELISA Kit

Sign In for Pricing
View Details
Cryba2 (NM_173140) Rat Tagged Lenti ORF Clone
RR201196L3 10 µg

Cryba2 (NM_173140) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Histone Cluster 1 H1 Family Member D (HIST1H1D) Antibody
abx242813-01 20 µL

Histone Cluster 1 H1 Family Member D (HIST1H1D) Antibody

Sign In for Pricing
View Details