Recombinant Human STEAP1 protein (STEAP1) -VLPs
This Recombinant Human Metalloreductase STEAP1 (STEAP1) -VLPs spans the amino acid sequence from region 1-339aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
Six-transmembrane epithelial antigen of prostate 1
UniProt
Q9UHE8
Expression Region
1-339aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
41.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15270206 1 Vial
Lentiviral mouse Ccdc54 shRNA (UAS) - Lentiviral mouse Ccdc54 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details