Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFB Peptide - C-terminal region

ETFB Peptide - C-terminal region

Product Specifications

Product Name Alternative

MADD

UniProt

P38117

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETFB Rabbit Polyclonal Antibody (orb330752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001976

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DKK3 shRNA Plasmid
abx974121-01 150 µg

Mouse DKK3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse DKK3 shRNA Plasmid
abx974121-02 300 µg

Mouse DKK3 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Neuroglycan C/CSPG5 Antibody
NBP2-56381 100 µL

Rabbit Polyclonal Neuroglycan C/CSPG5 Antibody

Sign In for Pricing
View Details
2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate
TRC-C555013-100MG 100 mg

2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate

Sign In for Pricing
View Details
Factor XIIIa (F13A1) (NM_000129) Human Tagged ORF Clone Lentiviral Particle
RC206464L3V 200 µL

Factor XIIIa (F13A1) (NM_000129) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KLHL33 Rabbit Polyclonal Antibody (Biotin)
orb2086045 100 µL

KLHL33 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details