Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2), partial

This Recombinant Influenza A virus Matrix protein 2 (M2), partial spans the amino acid sequence from region 1-22aa&44-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A088G224

Expression Region

1-22aa&44-97aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Influenza A virus (A/New York/WC-LVD-14-006/2014 (H1N1) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETPTRSEWECRCSGSGGGGSGGGGSDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xanthorrhizol (Technical grade)
TRC-X742075-5MG 5 mg

Xanthorrhizol (Technical grade)

Sign In for Pricing
View Details
Perfluoro-1-iododecane
TRC-P286530-5G 5 g

Perfluoro-1-iododecane

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), Biotin conjugate, 0.1mg/mL
BNCB2468-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human IL10RB/IL10R2 Protein (His Tag)
PKSH033389-01 10 µg

Recombinant Human IL10RB/IL10R2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL10RB/IL10R2 Protein (His Tag)
PKSH033389-02 50 µg

Recombinant Human IL10RB/IL10R2 Protein (His Tag)

Sign In for Pricing
View Details
FKBP9 Human Gene Knockout Kit (CRISPR)
KN422307 1 Kit

FKBP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details