Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pinctada fucata Extrapallial fluid protein EP18 (N82H)

This Recombinant Pinctada fucata Extrapallial fluid protein EP18 (N82H) spans the amino acid sequence from region 18-148aa (N82H) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1C8JY05

Expression Region

18-148aa (N82H)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VERVCPLGWISYKKHCYMIVSKPTQSWFNANIQCENQNSTLAKLDSRSELEWIYQRLLARNEPVHFWIGGNRLKRFEEWRWVSDGQRIEFFDFYKTQPNQNTSLCIVLWHPFKYDWADEPCTSSYGYICKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAP40 Rabbit Polyclonal Antibody (APC-Cy7)
orb2541776 100 µL

HAP40 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Inhibitor mmu-miR-130a-5p AAV miRNA Vector
Amm3009800 500 ng

Inhibitor mmu-miR-130a-5p AAV miRNA Vector

Sign In for Pricing
View Details
AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 550)
MBS6210198-01 0.1 mL

AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 550)

Sign In for Pricing
View Details
AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 550)
MBS6210198-02 5x 0.1 mL

AMY2B (Alpha-amylase 2B, 1,4-alpha-D-glucan Glucanohydrolase 2B, Carcinoid alpha-amylase) (MaxLight 550)

Sign In for Pricing
View Details
4α-Phorbol 12,13-didecanoate
HY-116291 1 mg

4α-Phorbol 12,13-didecanoate

Sign In for Pricing
View Details
Human CDC42 Protein, GST Tag
E40KMPH1175 20 µg

Human CDC42 Protein, GST Tag

Sign In for Pricing
View Details