Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

This Recombinant Mouse Interleukin-13 (Il13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

UniProt

P20109

Expression Region

19-131aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BI-8668
HY-160208 1 Each

BI-8668

Sign In for Pricing
View Details
RGD1564419 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV645509 1.0 µg DNA

RGD1564419 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Fish Ganglioside Q1B Antibody ELISA Kit
MBS032686 Inquire

Fish Ganglioside Q1B Antibody ELISA Kit

Sign In for Pricing
View Details
Drosophila melanogaster yata Rabbit Polyclonal Antibody (Cy3)
orb2985638 200 µL

Drosophila melanogaster yata Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 750)
MBS6380570-01 0.1 mL

GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 750)

Sign In for Pricing
View Details
GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 750)
MBS6380570-02 5x 0.1 mL

GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 750)

Sign In for Pricing
View Details