Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial-VLPs

This Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial-VLPs spans the amino acid sequence from region 396-800aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

GluN1; Glutamate [NMDA] receptor subunit zeta-1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1

UniProt

P35439

Expression Region

396-800aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMR3B, Human (HEK293, His)
HY-P77491-01 5 µg

SMR3B, Human (HEK293, His)

Sign In for Pricing
View Details
SMR3B, Human (HEK293, His)
HY-P77491-02 10 µg

SMR3B, Human (HEK293, His)

Sign In for Pricing
View Details
SMR3B, Human (HEK293, His)
HY-P77491-03 50 µg

SMR3B, Human (HEK293, His)

Sign In for Pricing
View Details
Chd2 Mouse siRNA Oligo Duplex (Locus ID 244059)
SR423229 1 Kit

Chd2 Mouse siRNA Oligo Duplex (Locus ID 244059)

Sign In for Pricing
View Details
Cat1 Antibody
PHY0014A 150 μg

Cat1 Antibody

Sign In for Pricing
View Details
LMO7 Rabbit Polyclonal Antibody (Fluoro488)
orb3103148 100 µg

LMO7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details