Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMR3B, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMR3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smr3b-protein-human-hek293-his.html

Purity

97.0

Smiles

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Molecular Formula

10879 (Gene_ID) P02814/NP_006676.1 (Q23-P79) (Accession)

Molecular Weight

Approximately 9 kDa

References & Citations

[1]Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282 (8) :5413-9.|[2]Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13 (6) :1876-1891.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEO1, ID (NEO1, IGDCC2, NGN, Neogenin, Immunoglobulin superfamily DCC subclass member 2) (MaxLight 490) discontinued
038892-ML490 100 µL

NEO1, ID (NEO1, IGDCC2, NGN, Neogenin, Immunoglobulin superfamily DCC subclass member 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ZNF155, CT (ZNF155, Zinc finger protein 155) (Azide free) (HRP)
MBS6365715-01 0.2 mL

ZNF155, CT (ZNF155, Zinc finger protein 155) (Azide free) (HRP)

Sign In for Pricing
View Details
ZNF155, CT (ZNF155, Zinc finger protein 155) (Azide free) (HRP)
MBS6365715-02 5x 0.2 mL

ZNF155, CT (ZNF155, Zinc finger protein 155) (Azide free) (HRP)

Sign In for Pricing
View Details
FAK (Phospho Tyr407) Polyclonal Antibody
MBS9459044-01 0.05 mL

FAK (Phospho Tyr407) Polyclonal Antibody

Sign In for Pricing
View Details
FAK (Phospho Tyr407) Polyclonal Antibody
MBS9459044-02 0.1 mL

FAK (Phospho Tyr407) Polyclonal Antibody

Sign In for Pricing
View Details
FAK (Phospho Tyr407) Polyclonal Antibody
MBS9459044-03 5x 0.1 mL

FAK (Phospho Tyr407) Polyclonal Antibody

Sign In for Pricing
View Details