Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMR3B, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMR3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smr3b-protein-human-hek293-his.html

Purity

97.0

Smiles

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Molecular Formula

10879 (Gene_ID) P02814/NP_006676.1 (Q23-P79) (Accession)

Molecular Weight

Approximately 9 kDa

References & Citations

[1]Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282 (8) :5413-9.|[2]Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13 (6) :1876-1891.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRG1 mouse mAb
RA10866-01 50 µL

BRG1 mouse mAb

Sign In for Pricing
View Details
BRG1 mouse mAb
RA10866-02 100 µL

BRG1 mouse mAb

Sign In for Pricing
View Details
NT5C1A (NM_032526) Human Tagged ORF Clone
RG224617 10 µg

NT5C1A (NM_032526) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal LMO2 Antibody (LMO2/3147R) [Alexa Fluor 405]
NBP3-08945AF405 100 µL

Rabbit Monoclonal LMO2 Antibody (LMO2/3147R) [Alexa Fluor 405]

Sign In for Pricing
View Details
GENLISA™ Human Neutrophil gelatinase - associated lipocalin (NGAL) ELISA
KBH1719 1x 96 Well

GENLISA™ Human Neutrophil gelatinase - associated lipocalin (NGAL) ELISA

Sign In for Pricing
View Details
FBXO10 siRNA (Human)
MBS8215971-01 15 nmol

FBXO10 siRNA (Human)

Sign In for Pricing
View Details