Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMR3B, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMR3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smr3b-protein-human-hek293-his.html

Purity

97.0

Smiles

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Molecular Formula

10879 (Gene_ID) P02814/NP_006676.1 (Q23-P79) (Accession)

Molecular Weight

Approximately 9 kDa

References & Citations

[1]Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282 (8) :5413-9.|[2]Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13 (6) :1876-1891.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEK Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62626R-BF750 100 µL

PLEK Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Bovine Ribonuclease P protein subunit p30, RPP30 ELISA KIT
ELI-52840b 96 Tests

Bovine Ribonuclease P protein subunit p30, RPP30 ELISA KIT

Sign In for Pricing
View Details
Recombinant Human MAP1LC3B Protein, His, E.coli-5ug
QP12636-5ug 5ug

Recombinant Human MAP1LC3B Protein, His, E.coli-5ug

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)
MBS1464482-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)
MBS1464482-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)
MBS1464482-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Protein NipSnap homolog (nipsnap)

Sign In for Pricing
View Details