Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMR3B, Human (HEK293, His)

SMR3B Protein is an important oncogenic driver that promotes cancer progression and metastasis. SMR3B overexpression in multiple cancers has pleiotropic effects, causing cells to acquire hallmark traits such as sustained proliferative signaling, replicative immortality, genome instability and mutation, resistance to cell death, angiogenesis etc. In addition, up-regulation of SMR3B activates the Src kinase, which initiates a number of signal pathways culminating in the phosphorylation of ERK1/2, STAT3, and p130. SMR3B Protein, Human (HEK293, His) is the recombinant human-derived SMR3B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMR3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smr3b-protein-human-hek293-his.html

Purity

97.0

Smiles

QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

Molecular Formula

10879 (Gene_ID) P02814/NP_006676.1 (Q23-P79) (Accession)

Molecular Weight

Approximately 9 kDa

References & Citations

[1]Liang F, et al. PRL3 promotes cell invasion and proliferation by down-regulation of Csk leading to Src activation. J Biol Chem. 2007 Feb 23;282 (8) :5413-9.|[2]Chia PL, et al. PRL3 as a therapeutic target for novel cancer immunotherapy in multiple cancer types. Theranostics. 2023 Mar 21;13 (6) :1876-1891.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll Like Receptor 6 (TLR6) ELISA Kit
RD-TLR6-Hu-96Tests 96 Tests

Human Toll Like Receptor 6 (TLR6) ELISA Kit

Sign In for Pricing
View Details
Glass fritted support for item AP47G300B
FRITTEDHEAD/APB 1 Piece

Glass fritted support for item AP47G300B

Sign In for Pricing
View Details
Ttll8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3874205 3x 1.0 µg

Ttll8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-Lamin A/C-S22 (Rabbit)
A115624 100 µL

Anti-Lamin A/C-S22 (Rabbit)

Sign In for Pricing
View Details
Agap3 Mouse shRNA Plasmid (Locus ID 213990)
TR506396 1 Kit

Agap3 Mouse shRNA Plasmid (Locus ID 213990)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YHFG Polyclonal Antibody
MBS7163782 Inquire

Rabbit anti-Escherichia coli (strain K12) YHFG Polyclonal Antibody

Sign In for Pricing
View Details