Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

This Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), patial spans the amino acid sequence from region 22-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r

UniProt

O35659

Expression Region

22-145aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody. The EC50 is 141.7-172.4 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Survivin Antibody
DL97600A-01 50 µL

Rabbit anti-Survivin Antibody

Sign In for Pricing
View Details
Rabbit anti-Survivin Antibody
DL97600A-02 100 µL

Rabbit anti-Survivin Antibody

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
RDR-MLH1-Hu-01 96 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
RDR-MLH1-Hu-02 48 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
MFSD8 (NM_152778) Human Tagged ORF Clone Lentiviral Particle
RC206118L4V 200 µL

MFSD8 (NM_152778) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human TNNC1 (Troponin C Type 1) ELISA Kit
RE2477H-01 48 Tests

Human TNNC1 (Troponin C Type 1) ELISA Kit

Sign In for Pricing
View Details