Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

This Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), patial spans the amino acid sequence from region 22-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r

UniProt

O35659

Expression Region

22-145aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody. The EC50 is 141.7-172.4 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces Cerevisiae RPC19 Protein (aa 1-142) [His]
VAng-Wyb5500-1mg 1 mg

Recombinant Saccharomyces Cerevisiae RPC19 Protein (aa 1-142) [His]

Sign In for Pricing
View Details
Anti-RS1 Antibody Picoband® Fluoro647 Conjugated
A01128-Fluoro647 100 µg/Vial

Anti-RS1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
HIVEP1 Rabbit Polyclonal Antibody (HRP)
orb2084030 100 µL

HIVEP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Repetin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9181R-BF555 100 µL

Repetin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PKC alpha Recombinant Rabbit mAb
orb2819825-01 25 µL

PKC alpha Recombinant Rabbit mAb

Sign In for Pricing
View Details
PKC alpha Recombinant Rabbit mAb
orb2819825-02 50 µL

PKC alpha Recombinant Rabbit mAb

Sign In for Pricing
View Details