Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIVEP1 Rabbit Polyclonal Antibody (HRP)

HIVEP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAAP, ZAS1, CIRIP, MBP-1, ZNF40, CRYBP1, ZNF40A, PRDII-BF1, Schnurri-1

UniProt

P15822

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HIVEP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lobaric acid
HY-117085 500 µg

Lobaric acid

Sign In for Pricing
View Details
Anti-HIF-1-alpha/HIF1A Antibody Picoband® (Carrier-free Conjugate)
PB9253-carrier-free 100 µg/Vial

Anti-HIF-1-alpha/HIF1A Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Rabbit Polyclonal JAKMIP2 Antibody
NBP3-05109-100ul 100 µL

Rabbit Polyclonal JAKMIP2 Antibody

Sign In for Pricing
View Details
TAP2 Antibody
OACD00688-100UL 100 µL

TAP2 Antibody

Sign In for Pricing
View Details
PCDHA1 Recombinant Protein
OPCD00710-200UG 200 µg

PCDHA1 Recombinant Protein

Sign In for Pricing
View Details
Acnat1 (NM_001164565) Mouse Tagged ORF Clone
MR214272 10 µg

Acnat1 (NM_001164565) Mouse Tagged ORF Clone

Sign In for Pricing
View Details