Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-84) (human)

PTH (1-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

9424.62

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid receptor/IL-6-IN-1
orb3173428-01 10 mg

Glucocorticoid receptor/IL-6-IN-1

Sign In for Pricing
View Details
Glucocorticoid receptor/IL-6-IN-1
orb3173428-02 50 mg

Glucocorticoid receptor/IL-6-IN-1

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial
MBS1371484-01 0.5 mg (E-Coli)

Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial
MBS1371484-02 0.05 mg (Baculovirus)

Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial
MBS1371484-03 0.5 mg (Yeast)

Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial
MBS1371484-04 0.05 mg (Mammalian-Cell)

Recombinant Synechococcus elongatus Photosystem I reaction center subunit IX (psaJ), partial

Sign In for Pricing
View Details