Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4282.96

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharum officinarum Cytochrome c biogenesis protein ccsA (ccsA)
orb2906058-01 20 µg

Recombinant Saccharum officinarum Cytochrome c biogenesis protein ccsA (ccsA)

Sign In for Pricing
View Details
Recombinant Saccharum officinarum Cytochrome c biogenesis protein ccsA (ccsA)
orb2906058-02 100 µg

Recombinant Saccharum officinarum Cytochrome c biogenesis protein ccsA (ccsA)

Sign In for Pricing
View Details
Mouse Monoclonal MHC Class I Antibody (MEM-E/08) [Alexa Fluor 700]
NB500-305AF700 0.1 mL

Mouse Monoclonal MHC Class I Antibody (MEM-E/08) [Alexa Fluor 700]

Sign In for Pricing
View Details
25I-NBF (hydrochloride)
HY-135241-01 1 mg

25I-NBF (hydrochloride)

Sign In for Pricing
View Details
25I-NBF (hydrochloride)
HY-135241-02 5 mg

25I-NBF (hydrochloride)

Sign In for Pricing
View Details
25I-NBF (hydrochloride)
HY-135241-03 10 mg

25I-NBF (hydrochloride)

Sign In for Pricing
View Details