Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG)

This Recombinant Human Interferon gamma (IFNG) spans the amino acid sequence from region 24-166aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; Immune interferon

UniProt

P01579

Expression Region

24-166aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicoverpa armigera OBP7
CSB-EP6907HVA-01 20 µg

Recombinant Helicoverpa armigera OBP7

Sign In for Pricing
View Details
Recombinant Helicoverpa armigera OBP7
CSB-EP6907HVA-02 100 µg

Recombinant Helicoverpa armigera OBP7

Sign In for Pricing
View Details
Recombinant Helicoverpa armigera OBP7
CSB-EP6907HVA-03 1 mg

Recombinant Helicoverpa armigera OBP7

Sign In for Pricing
View Details
CTSK AAV siRNA Pooled Vector
17102161 1.0 µg

CTSK AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Tyrosyl tRNA synthetase, CT (YARS, CMTDIC, TYRRS, YRS, YTS) (AP) discontinued
T9248-87G-AP 200 µL

Tyrosyl tRNA synthetase, CT (YARS, CMTDIC, TYRRS, YRS, YTS) (AP) discontinued

Sign In for Pricing
View Details
Human PBLD siRNA
abx927828-01 15 nmol

Human PBLD siRNA

Sign In for Pricing
View Details