Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicoverpa armigera OBP7

Product Specifications

Abbreviation

Recombinant Helicoverpa armigera OBP7 protein

UniProt

F5ANI5

Expression Region

22-148aa

Organism

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)

Target Sequence

LSSEEELSIKEALHPFVVECAEEYGMTEEMFEEAKKKGSAEDIDPCFMSCFLKKTGFFDDSGKFDAEKSISFAKEHITSESAIKFLEAGAGECVKINDEDVSDGENGCDRAKLLFDCLTELKKKMSE

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAD67/GAD1 Antibody Picoband®, APC Conjugate
PA1036-1-APC 100 µg/Vial

Anti-GAD67/GAD1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
CGB8 Antibody
E315318 100 µg - 200 µL

CGB8 Antibody

Sign In for Pricing
View Details
RAB12 Antibody
A58726-50UG 50 µg

RAB12 Antibody

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV A5L Protein, C-His
EVV17101 100 μg

Recombinant Monkeypox virus/MPXV A5L Protein, C-His

Sign In for Pricing
View Details
SART1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-7874R-PE-Cy5 100 µL

SART1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
NANS sgRNA CRISPR Lentivector (Human) (Target 1)
K1389702 1.0 µg DNA

NANS sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details