Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O6:H1 Uncharacterized deoxyribonuclease YcfH (ycfH)

This Recombinant Uncharacterized deoxyribonuclease YcfH (ycfH) spans the amino acid sequence from region 1-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0AFQ8

Expression Region

1-265aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFLVDSHCHLDGLDYESLHKDVDDVLAKAAARDVKFCLAVATTLPGYLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRLAAEEGVVALGETGLDYYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGGVLHCFTEDRETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFHIDASRLQSIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRFI-165
MBS5812610 Inquire

IRFI-165

Sign In for Pricing
View Details
1- (2,4-Difluorophenyl) -1H-pyrazole-3-carboxylic acid
CWB53385-01 50 mg

1- (2,4-Difluorophenyl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
1- (2,4-Difluorophenyl) -1H-pyrazole-3-carboxylic acid
CWB53385-02 0.5 g

1- (2,4-Difluorophenyl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
OR2D2 shRNA Plasmid (h)
sc-96789-SH 20 µg

OR2D2 shRNA Plasmid (h)

Sign In for Pricing
View Details
GATA Binding Protein 5 (GATA5) Monkey ELISA Kit
D6442 96 Tests

GATA Binding Protein 5 (GATA5) Monkey ELISA Kit

Sign In for Pricing
View Details
Recombinant human NAT1 protein
ATGP1110-050 50 µg

Recombinant human NAT1 protein

Sign In for Pricing
View Details