Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Peptide - middle region

Prrx2 Peptide - middle region

Product Specifications

Product Name Alternative

Prx2, S8

UniProt

Q06348

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx2 Rabbit Polyclonal Antibody (orb576450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033142

Preservative

Lyophilized powder

AA Sequence

AKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMSPDYLSWPASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX4 Rabbit Polyclonal Antibody (Fluoro550)
orb3076548 100 µg

SOX4 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
HPF1 Peptide - N-terminal region
orb2002767 100 µg

HPF1 Peptide - N-terminal region

Sign In for Pricing
View Details
HAT1 (N-term) Rabbit Polyclonal Antibody
AP11103PU-N 400 µL

HAT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Egln2 antibody - C-terminal region (ARP39776_P050)
ARP39776_P050 100 µL

Egln2 antibody - C-terminal region (ARP39776_P050)

Sign In for Pricing
View Details
hsa-miR-3074-5p miRNA Agomir
MBS8312080-01 5 nmol

hsa-miR-3074-5p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-3074-5p miRNA Agomir
MBS8312080-02 10 nmol

hsa-miR-3074-5p miRNA Agomir

Sign In for Pricing
View Details