Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPF1 Peptide - N-terminal region

HPF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf27

UniProt

Q9NWY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPF1 Rabbit Polyclonal Antibody (orb587077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060337

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nsd3 shRNA (UAS) - Lentiviral mouse Nsd3 shRNA (UAS, RFP) (100)
GTR15254640 1 Vial

Lentiviral mouse Nsd3 shRNA (UAS) - Lentiviral mouse Nsd3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SCYL1 Protein Vector (Rat) (pPB-N-His)
PV303687 500 ng

SCYL1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 3, Group C, Member 1 Phospho-Ser226 (NR3C1 pS226) Antibody
abx328986-01 50 µg

Nuclear Receptor Subfamily 3, Group C, Member 1 Phospho-Ser226 (NR3C1 pS226) Antibody

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 3, Group C, Member 1 Phospho-Ser226 (NR3C1 pS226) Antibody
abx328986-02 100 µg

Nuclear Receptor Subfamily 3, Group C, Member 1 Phospho-Ser226 (NR3C1 pS226) Antibody

Sign In for Pricing
View Details
PTPLAD2 ORF Vector (Human) (pORF)
ORF028559 1.0 µg DNA

PTPLAD2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Nandrolone Octanoate-d15
TRC-N315062-25MG 25 mg

Nandrolone Octanoate-d15

Sign In for Pricing
View Details