Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pus1 Peptide - N-terminal region

Pus1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A730013B20Rik, MPUS1, mPus1p

UniProt

Q9WU56

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pus1 Rabbit Polyclonal Antibody (orb576259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020733

Preservative

Lyophilized powder

AA Sequence

GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-Nanog Antibody
HY000187 0.1 mL

SensiStain™ Anti-Nanog Antibody

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI8A7]
CF813085 100 µg

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI8A7]

Sign In for Pricing
View Details
GPR113 (ADGRF3) (NM_001145168) Human Over-expression Lysate
LC428740 20 µg

GPR113 (ADGRF3) (NM_001145168) Human Over-expression Lysate

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF647 conjugate, 0.1mg/mL
BNC472083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMPRSS5 antibody
FNab08807 100 µg

TMPRSS5 antibody

Sign In for Pricing
View Details
4-(Diisopropylamino)benzonitrile
TRC-D282510-1G 1 g

4-(Diisopropylamino)benzonitrile

Sign In for Pricing
View Details