Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A730011L01Rik Peptide - middle region

A730011L01Rik Peptide - middle region

Product Specifications

Product Name Alternative

Endov, A730011L01Rik

UniProt

Q8C9A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endov Rabbit Polyclonal Antibody (orb326022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158108

Preservative

Lyophilized powder

AA Sequence

VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4703607 1.0 µg DNA

Tbc1d16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GLTP Polyclonal Antibody, Cy5.5 Conjugated
bs-42353R-Cy5.5 100 µL

GLTP Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
KLHL6 Antibody (C-term)
E45R05677G-1 100 µL

KLHL6 Antibody (C-term)

Sign In for Pricing
View Details
Hsp90aa1 Antibody - C-terminal region : FITC (ARP61232_P050-FITC)
ARP61232_P050-FITC 100 µL

Hsp90aa1 Antibody - C-terminal region : FITC (ARP61232_P050-FITC)

Sign In for Pricing
View Details
LPPR5 Antibody
A49657-100UL 100 µL

LPPR5 Antibody

Sign In for Pricing
View Details
GDF-5 (BMP-14/CDMP-1)
100-389-L1000 1000 µg

GDF-5 (BMP-14/CDMP-1)

Sign In for Pricing
View Details