Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP10 Peptide - middle region

AKAP10 Peptide - middle region

Product Specifications

Product Name Alternative

D-AKAP2, MGC9414, PRKA10

UniProt

O43572

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKAP10 Rabbit Polyclonal Antibody (orb329866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009133

Preservative

Lyophilized powder

AA Sequence

ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 Recombinant Mouse Monoclonal Antibody [A1G3-R]
HA601246 100 µL

CD10 Recombinant Mouse Monoclonal Antibody [A1G3-R]

Sign In for Pricing
View Details
PCDHA10 Protein Lysate (Human) with C-Ha Tag
36122031 100 µg

PCDHA10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Fish Chromosome 20 Open Reading Frame 94 (C20ORF94) ELISA Kit
MBS9918820 Inquire

Fish Chromosome 20 Open Reading Frame 94 (C20ORF94) ELISA Kit

Sign In for Pricing
View Details
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]
TA804756 100 µL

Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI8H5]

Sign In for Pricing
View Details
Chlorobenzene
sc-239517 250 mL

Chlorobenzene

Sign In for Pricing
View Details
1,2-Dichlorobenzene 99% AR For Extraction Analysis
0963A 00500 500 mL

1,2-Dichlorobenzene 99% AR For Extraction Analysis

Sign In for Pricing
View Details