Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3S1 Peptide - C-terminal region

AP3S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLAPS3, Sigma3A

UniProt

Q92572

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3S1 Rabbit Polyclonal Antibody (orb581504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001275

Preservative

Lyophilized powder

AA Sequence

IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS8 Rabbit Monoclonal Antibody [Clone ID: R09-2B2]
TA384849 100 µL

NDUFS8 Rabbit Monoclonal Antibody [Clone ID: R09-2B2]

Sign In for Pricing
View Details
Avrainvillamide
HY-N10264 250 µg

Avrainvillamide

Sign In for Pricing
View Details
FAM47C Human Gene Knockout Kit (CRISPR)
KN419047 1 Kit

FAM47C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF547 Antibody - N-terminal region : FITC (ARP37837_P050-FITC)
ARP37837_P050-FITC 100 µL

ZNF547 Antibody - N-terminal region : FITC (ARP37837_P050-FITC)

Sign In for Pricing
View Details
Recombinant Bovine Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)
MBS1010092-01 0.02 mg (E-Coli)

Recombinant Bovine Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)

Sign In for Pricing
View Details
Recombinant Bovine Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)
MBS1010092-02 0.1 mg (E-Coli)

Recombinant Bovine Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)

Sign In for Pricing
View Details