Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP1 Peptide - middle region

ARFGAP1 Peptide - middle region

Product Specifications

Product Name Alternative

ARF1GAP, HRIHFB2281, MGC39924

UniProt

Q8N6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFGAP1 Rabbit Polyclonal Antibody (orb583463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060679

Preservative

Lyophilized powder

AA Sequence

GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCK (NM_002110) Human Over-expression Lysate
LC419528 20 µg

HCK (NM_002110) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha Fodrin (SPTAN1) (NM_003127) Human Recombinant Protein
TP318210 20 µg

Alpha Fodrin (SPTAN1) (NM_003127) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human MMP7 protein (N-His)
PKSH034171-01 20 µg

Recombinant Human MMP7 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human MMP7 protein (N-His)
PKSH034171-02 100 µg

Recombinant Human MMP7 protein (N-His)

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), Biotin conjugate, 0.1mg/mL
BNCB0781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPYD (NM_000110) Human Over-expression Lysate
LC424917 20 µg

DPYD (NM_000110) Human Over-expression Lysate

Sign In for Pricing
View Details