Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP28 Peptide - C-terminal region

ARHGAP28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686A2038, FLJ10312

UniProt

Q9P2N2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP28 Rabbit Polyclonal Antibody (orb582126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010000

Preservative

Lyophilized powder

AA Sequence

TKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGEHCLDPDAYILDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMID (AIFM2) Rabbit Polyclonal Antibody
AP11347PU-N 400 µL

AMID (AIFM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-01 20 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-02 100 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-03 500 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-04 1 mg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Human ProS1 Protein, His Tag
PR1-H52H4-1mg 1 mg

Human ProS1 Protein, His Tag

Sign In for Pricing
View Details