Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP1 Peptide - C-terminal region

ARL6IP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIP1, ARL6IP, ARMER, KIAA0069

UniProt

Q15041

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL6IP1 Rabbit Polyclonal Antibody (orb585043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055976

Preservative

Lyophilized powder

AA Sequence

QVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mefenamic Acyl-Beta-D-glucuronide
TRC-M205060-5MG 5 mg

Mefenamic Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details
CHKL (CHKB) (NM_005198) Human Recombinant Protein
TP310253M 100 µg

CHKL (CHKB) (NM_005198) Human Recombinant Protein

Sign In for Pricing
View Details
HSP90 Beta Mouse Monoclonal Antibody [2-1-G3]
EM21103 100 µL

HSP90 Beta Mouse Monoclonal Antibody [2-1-G3]

Sign In for Pricing
View Details
Recombinant Mouse REG3B/Pap1 Protein (His Tag)
PKSM040337 50 µg

Recombinant Mouse REG3B/Pap1 Protein (His Tag)

Sign In for Pricing
View Details
CHST10 Rabbit Polyclonal Antibody
TA369977 100 µL

CHST10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rubicon (RUBCN) Rabbit Polyclonal Antibody
TA381187 100 µL

Rubicon (RUBCN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details