Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL8B Peptide - middle region

ARL8B Peptide - middle region

Product Specifications

Product Name Alternative

ARL10C, FLJ10702, Gie1

UniProt

Q9NVJ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL8B Rabbit Polyclonal Antibody (orb583456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060654

Preservative

Lyophilized powder

AA Sequence

DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Meis homeobox 3 Antibody (OTI3A7) [mFluor Violet 450 SE]
NBP2-72641MFV450 0.1 mL

Mouse Monoclonal Meis homeobox 3 Antibody (OTI3A7) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Macaca mulatta Oncostatin M (OSM), partial
CSB-MP2949MOW-01 10 µg

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Oncostatin M (OSM), partial
CSB-MP2949MOW-02 50 µg

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Oncostatin M (OSM), partial
CSB-MP2949MOW-03 200 µg

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Oncostatin M (OSM), partial
CSB-MP2949MOW-04 500 µg

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Sign In for Pricing
View Details
Recombinant Macaca mulatta Oncostatin M (OSM), partial
CSB-MP2949MOW-05 20 µg

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Sign In for Pricing
View Details