Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Oncostatin M (OSM), partial

Product Specifications

Abbreviation

Recombinant Rhesus macaque OSM protein, partial

Gene Name

OSM

UniProt

F7GF43

Expression Region

22-252aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Evolutionary and biomedical insights from the rhesus macaque genome." Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Wilson R.K., Batzer M.A., Bustamante C.D., Eichler E.E., Hahn M.W., Hardison R.C., Makova K.D., Miller W., Milosavljevic A. Zwieg A.S. Science 316:222-234 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (MaxLight 750)
MBS6392109-01 0.1 mL

RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (MaxLight 750)

Sign In for Pricing
View Details
RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (MaxLight 750)
MBS6392109-02 5x 0.1 mL

RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Monoclonal Cystathionase Antibody (OTI1E12) [Allophycocyanin]
NBP2-70488APC 0.1 mL

Mouse Monoclonal Cystathionase Antibody (OTI1E12) [Allophycocyanin]

Sign In for Pricing
View Details
Recombinant Pisum sativum Chlorophyll a-b binding protein AB80, chloroplastic (AB80)
MBS1108683 Inquire

Recombinant Pisum sativum Chlorophyll a-b binding protein AB80, chloroplastic (AB80)

Sign In for Pricing
View Details
Benzyl (14-amino-3,6,9,12-tetraoxatetradecyl) carbamate
OR1043275-01 100 mg

Benzyl (14-amino-3,6,9,12-tetraoxatetradecyl) carbamate

Sign In for Pricing
View Details
Benzyl (14-amino-3,6,9,12-tetraoxatetradecyl) carbamate
OR1043275-02 250 mg

Benzyl (14-amino-3,6,9,12-tetraoxatetradecyl) carbamate

Sign In for Pricing
View Details