Arsb Peptide - middle region
Arsb Peptide - middle region
Product Specifications
Product Name Alternative
1110007C02Rik, AI480648, As-1, As-1r, As-1s, As-1t, As1, As1-r, As1-s, As1-t, Asr-1, Ast-1
UniProt
P50429
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Arsb Rabbit Polyclonal Antibody (orb584138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033842
Preservative
Lyophilized powder
AA Sequence
TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0006113 96 Well Plate
Human Regulated Endocrine Specific Protein 18 (RESP18) ELISA Kit
Sign In for Pricing
View Details 
APRab60092-01 50 µL
CHIKV Spike glycoprotein E2 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab60092-02 100 µL
CHIKV Spike glycoprotein E2 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details