Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haptoglobin (HP) (NM_005143) Human Over-expression Lysate
LC401576 20 µg

Haptoglobin (HP) (NM_005143) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem147 (N-term) Rabbit Polyclonal Antibody
AP46073PU-N 100 µL

Tmem147 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPART (NM_001142295) Human Recombinant Protein
TP327162 20 µg

SPART (NM_001142295) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS708873 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
MAPT / TAU pSer422 Rabbit Polyclonal Antibody
AP08020PU-N 100 µL

MAPT / TAU pSer422 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MTURN activation kit by CRISPRa
GA116656 1 Kit

Human MTURN activation kit by CRISPRa

Sign In for Pricing
View Details