Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPTC Antibody
KC-3985-01 50 μL

OPTC Antibody

Sign In for Pricing
View Details
OPTC Antibody
KC-3985-02 100 µL

OPTC Antibody

Sign In for Pricing
View Details
OPTC Antibody
KC-3985-03 1 mL

OPTC Antibody

Sign In for Pricing
View Details
Rab27b (BC018443) Mouse Tagged ORF Clone
MG201117 10 µg

Rab27b (BC018443) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lambda Light Chain Recombinant Mouse monoclonal Antibody
HA610142 100 µg

Lambda Light Chain Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-IKB alpha (S32) Antibody [ST53-05]
ET1609-78TR 20 µL

Anti-Phospho-IKB alpha (S32) Antibody [ST53-05]

Sign In for Pricing
View Details