Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA4, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa4-protein-human-his.html

Purity

95

Smiles

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Molecular Formula

6291 (Gene_ID) P35542 (E19-Y130) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S,3R,4E)-2-Amino-4-hepten-1,3-diol
TRC-A609950-25MG 25 mg

(2S,3R,4E)-2-Amino-4-hepten-1,3-diol

Sign In for Pricing
View Details
TIRAP Recombinant Rabbit Monoclonal Antibody [JE46-35]
HA722001 100 µL

TIRAP Recombinant Rabbit Monoclonal Antibody [JE46-35]

Sign In for Pricing
View Details
O-(2-Acetamido-2-deoxy-D-glucopyranosyl)-L-serine
TRC-A157310-5MG 5 mg

O-(2-Acetamido-2-deoxy-D-glucopyranosyl)-L-serine

Sign In for Pricing
View Details
MyTemp™ Mini Digital Incubator, with heating and cooling 115V
H2200-HC 1 Each

MyTemp™ Mini Digital Incubator, with heating and cooling 115V

Sign In for Pricing
View Details
CD30 (CD30/412), CF640R conjugate, 0.1mg/mL
BNC400412-100 1x 100 µL

CD30 (CD30/412), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENPP2 Rabbit Polyclonal Antibody
AP05178PU-N 100 µg

ENPP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details