Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVPR1A Peptide - C-terminal region

AVPR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

AVPR1

UniProt

P37288

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AVPR1A Rabbit Polyclonal Antibody (orb331205) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000697

Preservative

Lyophilized powder

AA Sequence

PCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNA3 Antibody
C51025-01 50 μL

KPNA3 Antibody

Sign In for Pricing
View Details
KPNA3 Antibody
C51025-02 100 µL

KPNA3 Antibody

Sign In for Pricing
View Details
Zebrafish PSMC4 Rabbit Polyclonal Antibody (Fluoro550)
orb3091047 100 µg

Zebrafish PSMC4 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
RAB11FIP1 Peptide - N-terminal region
orb2004832 100 µg

RAB11FIP1 Peptide - N-terminal region

Sign In for Pricing
View Details
Goose Peroxisome Proliferators Activated Receptor alpha ELISA Kit
MBS008060 Inquire

Goose Peroxisome Proliferators Activated Receptor alpha ELISA Kit

Sign In for Pricing
View Details
1- (4-Chlorophenyl) -4-oxo-1,4-dihydro-3-pyridazinecarboxylic acid
sc-302365 500 mg

1- (4-Chlorophenyl) -4-oxo-1,4-dihydro-3-pyridazinecarboxylic acid

Sign In for Pricing
View Details