Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP1 Peptide - N-terminal region

RAB11FIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NOEL1A, RCP, rab11-FIP1

UniProt

Q6WKZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11FIP1 Rabbit Polyclonal Antibody (orb586168) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079427

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K03861 (AUZ454)
S8100-5mg 5 mg

K03861 (AUZ454)

Sign In for Pricing
View Details
Trim44 3'UTR Luciferase Stable Cell Line
TU121111 1.0 mL

Trim44 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RPL7AP18 sgRNA CRISPR Lentivector set (Human)
K1883101 3x 1.0 µg

RPL7AP18 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PAX4 Antibody
orb1332203 100 µg

PAX4 Antibody

Sign In for Pricing
View Details
SI Rabbit Polyclonal Antibody (HRP)
orb2610454 100 µg

SI Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SCRN1 AAV Vector (Rat) (CMV)
43202106 1 µg

SCRN1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details