Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL Peptide - C-terminal region

AXL Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK11, UFO

UniProt

P30530

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AXL Rabbit Polyclonal Antibody (orb584194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001690

Preservative

Lyophilized powder

AA Sequence

QPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Periostin/OSF-2 Protein (His Tag)
PKSH030453 100 µg

Recombinant Human Periostin/OSF-2 Protein (His Tag)

Sign In for Pricing
View Details
Mouse H2-Aa activation kit by CRISPRa
GA201802 1 Kit

Mouse H2-Aa activation kit by CRISPRa

Sign In for Pricing
View Details
Antazoline Hydrochloride
TRC-A678405-1G 1 g

Antazoline Hydrochloride

Sign In for Pricing
View Details
Recombinant Human NFYA Protein
PKSH032824-01 10 µg

Recombinant Human NFYA Protein

Sign In for Pricing
View Details
Recombinant Human NFYA Protein
PKSH032824-02 50 µg

Recombinant Human NFYA Protein

Sign In for Pricing
View Details
FLVCR2 (NM_001195283) Human Over-expression Lysate
LC434160 20 µg

FLVCR2 (NM_001195283) Human Over-expression Lysate

Sign In for Pricing
View Details