B230358A15Rik Peptide - middle region
B230358A15Rik Peptide - middle region
Product Specifications
Product Name Alternative
HSF 3, mHSF3, HSTF 3, B230358A15Rik, RP23-348N10.1
UniProt
Q8BL67
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with B230358A15Rik Rabbit Polyclonal Antibody (orb324714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766519
Preservative
Lyophilized powder
AA Sequence
EDKYKSLLDRVMPILKESKKLISSGDQPSGDDGEHPKVPVQDKPMNEESL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3642-100 1x 100 µL
ATG5 (Autophagy Marker) (rATG5/2553), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
K013-HX5 10 Plates
Hemoglobin High Sensitivity Colorimetric Detection Kit
Sign In for Pricing
View Details 
TP309724L 1 mg
Cytochrome C (CYCS) (NM_018947) Human Recombinant Protein
Sign In for Pricing
View Details 