Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS4 Peptide - N-terminal region

BBS4 Peptide - N-terminal region

Product Specifications

UniProt

Q96RK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS4 Rabbit Polyclonal Antibody (orb583671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149017

Preservative

Lyophilized powder

AA Sequence

YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shh Antibody / Sonic Hedgehog
F53217-0.4ML 0.4 mL

Shh Antibody / Sonic Hedgehog

Sign In for Pricing
View Details
Mouse Monoclonal Nectin-1/PVRL1 Antibody (R1.302) [PE]
NBP2-54643PE 0.1 mL

Mouse Monoclonal Nectin-1/PVRL1 Antibody (R1.302) [PE]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)
MBS7014740-01 0.02 mg

Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)
MBS7014740-02 0.1 mg

Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)
MBS7014740-03 5x 0.1 mg

Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)

Sign In for Pricing
View Details
SYTL4 siRNA (Rat)
MBS8202015-01 15 nmol

SYTL4 siRNA (Rat)

Sign In for Pricing
View Details