Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Peptide - C-terminal region

BRCC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRCC36, C6.1A, CXorf53, RP11-143H17.2

UniProt

P46736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRCC3 Rabbit Polyclonal Antibody (orb585188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_077308

Preservative

Lyophilized powder

AA Sequence

HNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR Monoclonal Antibody
E-AB-22010-01 20 µL

AMACR Monoclonal Antibody

Sign In for Pricing
View Details
AMACR Monoclonal Antibody
E-AB-22010-02 60 µL

AMACR Monoclonal Antibody

Sign In for Pricing
View Details
AMACR Monoclonal Antibody
E-AB-22010-03 120 µL

AMACR Monoclonal Antibody

Sign In for Pricing
View Details
AMACR Monoclonal Antibody
E-AB-22010-04 200 µL

AMACR Monoclonal Antibody

Sign In for Pricing
View Details
CD252 (TNFSF4) (NM_003326) Human Recombinant Protein
TP324021L 1 mg

CD252 (TNFSF4) (NM_003326) Human Recombinant Protein

Sign In for Pricing
View Details
Emetine (>90%)
TRC-E521530-1MG 1 mg

Emetine (>90%)

Sign In for Pricing
View Details