Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btrc Peptide - C-terminal region

Btrc Peptide - C-terminal region

Product Specifications

Product Name Alternative

Beta-Trcp1, FWD1, Fbw1a, KIAA4123, Slimb, b-TrCP, beta-TrCP, mKIAA4123, HOS

UniProt

Q3ULA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Btrc Rabbit Polyclonal Antibody (orb578362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032847

Preservative

Lyophilized powder

AA Sequence

LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADM Antibody
OACA07093-100UL 100 µL

ACADM Antibody

Sign In for Pricing
View Details
Mouse Monoclonal PI 3-Kinase p110 delta Antibody (OTI1D11) [Alexa Fluor 405]
NBP2-73396AF405 0.1 mL

Mouse Monoclonal PI 3-Kinase p110 delta Antibody (OTI1D11) [Alexa Fluor 405]

Sign In for Pricing
View Details
UEVLD Antibody
MBS7120223-01 0.05 mg

UEVLD Antibody

Sign In for Pricing
View Details
UEVLD Antibody
MBS7120223-02 0.1 mg

UEVLD Antibody

Sign In for Pricing
View Details
UEVLD Antibody
MBS7120223-03 5x 0.1 mg

UEVLD Antibody

Sign In for Pricing
View Details
Pico145
orb1218692-01 200 mg

Pico145

Sign In for Pricing
View Details