Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, IL1BC, P45

UniProt

P29466

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP1 Rabbit Polyclonal Antibody (orb333727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001214

Preservative

Lyophilized powder

AA Sequence

LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK1, NT (MARK1, KIAA1477, MARK, Serine/threonine-protein kinase MARK1, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c)
MBS6004032-01 0.2 mL

MARK1, NT (MARK1, KIAA1477, MARK, Serine/threonine-protein kinase MARK1, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c)

Sign In for Pricing
View Details
MARK1, NT (MARK1, KIAA1477, MARK, Serine/threonine-protein kinase MARK1, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c)
MBS6004032-02 5x 0.2 mL

MARK1, NT (MARK1, KIAA1477, MARK, Serine/threonine-protein kinase MARK1, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c)

Sign In for Pricing
View Details
CDC73 Antibody
63-825 400 µL

CDC73 Antibody

Sign In for Pricing
View Details
CUL5 Antibody
MBS8516740-01 0.1 mg

CUL5 Antibody

Sign In for Pricing
View Details
CUL5 Antibody
MBS8516740-02 0.1 mL (AF635)

CUL5 Antibody

Sign In for Pricing
View Details
CUL5 Antibody
MBS8516740-03 0.1 mL (AF610)

CUL5 Antibody

Sign In for Pricing
View Details