Cbfa2t2 Peptide - middle region
Cbfa2t2 Peptide - middle region
Product Specifications
Product Name Alternative
A430091M07, C330013D05Rik, Cbfa2t2h, MTGR1
UniProt
O70374
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cbfa2t2 Rabbit Polyclonal Antibody (orb576332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766448
Preservative
Lyophilized powder
AA Sequence
AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
L8001-05-PE 100 µL
Lyme Disease (Borrelia burgdorferi) (PE) discontinued
Sign In for Pricing
View Details 
143609-PE 100 µL
IL19 (ZMDA1, Interleukin-19, IL-19, Melanoma Differentiation-associated Protein-like Protein, NG.1) (PE) discontinued
Sign In for Pricing
View Details MBS6238480-01 0.1 mL
GLRX (Glutaredoxin (Thioltransferase), GRX, GRX1, MGC117407) (MaxLight 750)
Sign In for Pricing
View Details