Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD33 Peptide - N-terminal region

CD33 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ00391, SIGLEC-3, SIGLEC3, p67

UniProt

P20138

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD33 Rabbit Polyclonal Antibody (orb585515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001763

Preservative

Lyophilized powder

AA Sequence

HPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGLUT2 Antibody, Clone N29/29
SMC-395D 100 µg

VGLUT2 Antibody, Clone N29/29

Sign In for Pricing
View Details
HDAC7 (A-7) Alexa Fluor® 546
sc-74563 AF546 200 µg/mL

HDAC7 (A-7) Alexa Fluor® 546

Sign In for Pricing
View Details
Dmtf1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7121004 1.0 µg DNA

Dmtf1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
TXNDC4 Antibody
OAEB01722-100UG 100 µg

TXNDC4 Antibody

Sign In for Pricing
View Details
Anti-POGZ Antibody Picoband® (Biotine Conjugate)
A06169-3-Biotin 100 µg/Vial

Anti-POGZ Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
AF488 Anti-Mouse CD8a Antibody
MBS4514510-01 50 Tests

AF488 Anti-Mouse CD8a Antibody

Sign In for Pricing
View Details