Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdc42ep4 Peptide - middle region

Cdc42ep4 Peptide - middle region

Product Specifications

UniProt

B1WC33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdc42ep4 Rabbit Polyclonal Antibody (orb582511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100533

Preservative

Lyophilized powder

AA Sequence

GSPKSPHRNGATGPHSPDPLLDEQAFGDLMDLPVMPKVSYGLKHAESILS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF384 activation kit by CRISPRa
GA116233 1 Kit

Human ZNF384 activation kit by CRISPRa

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3276), 0.2mg/mL
BNUB3276-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3276), 0.2mg/mL

Sign In for Pricing
View Details
HINT1 Rabbit Polyclonal Antibody
TA367077 100 µL

HINT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene M RAM
HAM0523.5G 5 g

Polystyrene M RAM

Sign In for Pricing
View Details
CST3 Polyclonal Antibody
D-AB-10163L-01 25 µL

CST3 Polyclonal Antibody

Sign In for Pricing
View Details
CST3 Polyclonal Antibody
D-AB-10163L-02 100 µL

CST3 Polyclonal Antibody

Sign In for Pricing
View Details